PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca41801.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 358aa    MW: 40908.4 Da    PI: 4.9752
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca41801.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.65.7e-54191441128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lppGfrFhPtdeel+++yL++k+ +  + + ++i evd++k+ePw+Lp+ +k +ek+wyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++ +++l
  Dca41801.1  19 LPPGFRFHPTDEELITNYLQPKALDIGFVA-RAIGEVDLNKCEPWELPRLAKLREKQWYFFCVRDRKYPTGLRTNRATEAGYWKATGKDKEIFR-DKTL 115
                 79*************************999.89***************8888899***************************************.999* PP

         NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128
                 +g+kktLvfykgrapkgekt+Wv+heyrl
  Dca41801.1 116 IGMKKTLVFYKGRAPKGEKTNWVIHEYRL 144
                 ***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.75E-6316170IPR003441NAC domain
PROSITE profilePS510055819169IPR003441NAC domain
PfamPF023652.7E-2820144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MENMEVVHVG GDEEEAMDLP PGFRFHPTDE ELITNYLQPK ALDIGFVARA IGEVDLNKCE  60
PWELPRLAKL REKQWYFFCV RDRKYPTGLR TNRATEAGYW KATGKDKEIF RDKTLIGMKK  120
TLVFYKGRAP KGEKTNWVIH EYRLDGPSSL QNLPSNSKNE WTICRVFHKN EEGKKFPFPG  180
CTRQESYETE YNPSGILPPL MESSPYNAAA TTTNNNNDND VLRVSCFSNP MDTSTSSSQN  240
CHFYDINQSY YDGFISNPIE SILNYHNDDY LQPQRGQFQG SYAMSEQYVL RDILENRVTE  300
TKERIKTEDV NHSASQSTGL NSDIHAEDSS IVSNYDIARP PFDDCGGPST SAGPLNYY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B6e-5381753171NAC domain-containing protein 19
4dul_A6e-5381753171NAC domain-containing protein 19
1ut7_B6e-5381753171NO APICAL MERISTEM PROTEIN
1ut7_A6e-5381753171NO APICAL MERISTEM PROTEIN
1ut4_B6e-5381753171NO APICAL MERISTEM PROTEIN
1ut4_A6e-5381753171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010678483.11e-157PREDICTED: NAC domain-containing protein 100
SwissprotQ9FLJ21e-116NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A0J8CFJ41e-157A0A0J8CFJ4_BETVU; Uncharacterized protein
STRINGVIT_17s0000g06400.t011e-120(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-115NAC domain containing protein 100